SCOPe 2.03: Domain d4gw5a2: 4gw5 A:108-212

Lineage for d4gw5a2 (4gw5 A:108-212)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Murinae,homo sapiens [TaxId:39107] [228176] (2 PDB entries)

8. Domain d4gw5a2: 4gw5 A:108-212 [234542]
   Other proteins in same PDB: d4gw5a1, d4gw5c1
   automated match to d4gw1c2
   complexed with po4

Details for d4gw5a2

PDB Entry: 4gw5, 2.2 Å

PDB Description: cqyn meditope - cetuximab fab

PDB Compounds: (A:) Fab light chain

SCOPe Domain Sequences for d4gw5a2:

Sequence; same for both SEQRES and ATOM records:

>d4gw5a2 b.1.1.2 (A:108-212) automated matches {Murinae,homo sapiens [TaxId: 39107]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d4gw5a2:

• d4gw5a2 is new in SCOPe 2.03-stable
  
• d4gw5a2 appears in SCOPe 2.04
  
• d4gw5a2 appears in the current release, SCOPe 2.08