SCOPe 2.08: Domain d4guzc1: 4guz C:1-278

Lineage for d4guzc1 (4guz C:1-278)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (23 species)
   not a true protein

7. Species Mycobacterium abscessus [TaxId:561007] [228435] (1 PDB entry)

8. Domain d4guzc1: 4guz C:1-278 [234539]
   Other proteins in same PDB: d4guza2, d4guzb2, d4guzc2, d4guzd2
   automated match to d4guzd_

Details for d4guzc1

PDB Entry: 4guz, 1.8 Å

PDB Description: structure of the arylamine n-acetyltransferase from mycobacterium abscessus

PDB Compounds: (C:) Probable arylamine n-acetyl transferase

SCOPe Domain Sequences for d4guzc1:

Sequence; same for both SEQRES and ATOM records:

>d4guzc1 d.3.1.0 (C:1-278) automated matches {Mycobacterium abscessus [TaxId: 561007]}
mwngdelqldeylafigfdgdrsptletlrrlqrghvlnikwenldavlhkhvaldipav
qakllrsprggycyehvalfgavlqrlgfdfygiqgrvqmgattirpathgmlvvrlaae
qwlcdvgfgtsplapirlvdeavvadeswtyrlrrgevtpgadgwtlseaagdgsepgwl
srhtfvlepqypidyraasyfvassphspfstrafvqqispdhayildhrelheiqpgvg
rktrqltpaevlatlreifgielgaddstlllerlaeq

Timeline for d4guzc1:

• d4guzc1 first appeared in SCOPe 2.03, called d4guzc_
  
• d4guzc1 appears in SCOPe 2.07