Lineage for d4gunj2 (4gun J:90-206)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647686Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1647687Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1647961Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1647962Protein automated matches [226860] (25 species)
    not a true protein
  7. 1648092Species Yeast (Candida albicans) [TaxId:5476] [226298] (2 PDB entries)
  8. 1648102Domain d4gunj2: 4gun J:90-206 [234525]
    Other proteins in same PDB: d4guna1, d4gunb1, d4gunc1, d4gund1, d4gune1, d4gunf1, d4gung1, d4gunh1, d4guni1, d4gunj1, d4gunk1, d4gunl1, d4gunm1, d4gunn1, d4guno1, d4gunp1
    automated match to d4gune2
    complexed with mn, so4; mutant

Details for d4gunj2

PDB Entry: 4gun (more details), 1.94 Å

PDB Description: Crystal Structure of the K184R, L185P mutant manganese superoxide dismutase from Candida albicans cytosol
PDB Compounds: (J:) superoxide dismutase

SCOPe Domain Sequences for d4gunj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gunj2 d.44.1.0 (J:90-206) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
vskgggkhpdtssalgkqivaqygsvsnliditnsklagiqgsgwafivknkqnggaldv
vttanqdtisaphlvpiiaidawehayylqyqnvrpdyfkaiwnvinwaeaesrysa

SCOPe Domain Coordinates for d4gunj2:

Click to download the PDB-style file with coordinates for d4gunj2.
(The format of our PDB-style files is described here.)

Timeline for d4gunj2: