SCOPe 2.05: Domain d4grla2: 4grl A:82-180

Lineage for d4grla2 (4grl A:82-180)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4grla2: 4grl A:82-180 [234509]
   Other proteins in same PDB: d4grla1, d4grlb1, d4grlc1
   automated match to d4maya2
   complexed with nag

Details for d4grla2

PDB Entry: 4grl, 2.86 Å

PDB Description: crystal structure of a autoimmune tcr-mhc complex

PDB Compounds: (A:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d4grla2:

Sequence; same for both SEQRES and ATOM records:

>d4grla2 b.1.1.2 (A:82-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsngqsvtegvsetsflsks
dhsffkisyltflpsadeiydckvehwgldqpllkhwep

Timeline for d4grla2:

• d4grla2 first appeared in SCOPe 2.03
  
• d4grla2 appears in SCOPe 2.04
  
• d4grla2 appears in SCOPe 2.06
  
• d4grla2 appears in the current release, SCOPe 2.08