SCOPe 2.07: Domain d4grlc1: 4grl C:2-113

Lineage for d4grlc1 (4grl C:2-113)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d4grlc1: 4grl C:2-113 [234504]
   Other proteins in same PDB: d4grla1, d4grla2, d4grlb1, d4grlb2, d4grlc2
   automated match to d4mayc1
   complexed with nag

Details for d4grlc1

PDB Entry: 4grl, 2.86 Å

PDB Description: crystal structure of a autoimmune tcr-mhc complex

PDB Compounds: (C:) TCR Hy.1B11 alpha chain

SCOPe Domain Sequences for d4grlc1:

Sequence; same for both SEQRES and ATOM records:

>d4grlc1 b.1.1.0 (C:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enveqhpstlsvqegdsavikctysdsasnyfpwykqelgkrpqliidirsnvgekkdqr
iavtlnktakhfslhitetqpedsavyfcaassfgnekltfgtgtrltiipn

Timeline for d4grlc1:

• d4grlc1 first appeared in SCOPe 2.03
  
• d4grlc1 appears in SCOPe 2.06
  
• d4grlc1 appears in the current release, SCOPe 2.08