Lineage for d4grlc1 (4grl C:2-113)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296708Domain d4grlc1: 4grl C:2-113 [234504]
    Other proteins in same PDB: d4grla1, d4grla2, d4grlb1, d4grlb2, d4grlc2
    automated match to d4mayc1
    complexed with nag

Details for d4grlc1

PDB Entry: 4grl (more details), 2.86 Å

PDB Description: Crystal structure of a autoimmune TCR-MHC complex
PDB Compounds: (C:) TCR Hy.1B11 alpha chain

SCOPe Domain Sequences for d4grlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4grlc1 b.1.1.0 (C:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
enveqhpstlsvqegdsavikctysdsasnyfpwykqelgkrpqliidirsnvgekkdqr
iavtlnktakhfslhitetqpedsavyfcaassfgnekltfgtgtrltiipn

SCOPe Domain Coordinates for d4grlc1:

Click to download the PDB-style file with coordinates for d4grlc1.
(The format of our PDB-style files is described here.)

Timeline for d4grlc1: