SCOPe 2.08: Domain d4grja_: 4grj A:

Lineage for d4grja_ (4grj A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein automated matches [190163] (13 species)
   not a true protein

7. Species Rhodnius prolixus [TaxId:13249] [187425] (3 PDB entries)

8. Domain d4grja_: 4grj A: [234495]
   automated match to d4gnwa_
   complexed with hem, no, po4; mutant

Details for d4grja_

PDB Entry: 4grj, 1.15 Å

PDB Description: crystal structure of nitrophorin 4 triple mutant complex with no

PDB Compounds: (A:) Nitrophorin-4

SCOPe Domain Sequences for d4grja_:

Sequence; same for both SEQRES and ATOM records:

>d4grja_ b.60.1.1 (A:) automated matches {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdylnlqpdnvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

Timeline for d4grja_:

• d4grja_ first appeared in SCOPe 2.03
  
• d4grja_ appears in SCOPe 2.07