Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
Protein automated matches [191100] (10 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [224925] (4 PDB entries) |
Domain d4gqwa_: 4gqw A: [234489] automated match to d4gqya_ |
PDB Entry: 4gqw (more details), 2.2 Å
SCOPe Domain Sequences for d4gqwa_:
Sequence, based on SEQRES records: (download)
>d4gqwa_ d.37.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gvytvgefmtkkedlhvvkptttvdealellvenritgfpvidedwklvglvsdydllal dsgdstwktfnavqkllsktngklvgdlmtpaplvveektnledaakilletkyrrlpvv dsdgklvgiitrgnvvraalq
>d4gqwa_ d.37.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} gvytvgefmtkkedlhvvkptttvdealellvenritgfpvidedwklvglvsdydllal dtwktfnavqklgklvgdlmtpaplvveektnledaakilletkyrrlpvvdsdgklvgi itrgnvvraalq
Timeline for d4gqwa_: