SCOPe 2.03: Domain d4gqwa_: 4gqw A:

Lineage for d4gqwa_ (4gqw A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (10 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [224925] (4 PDB entries)

8. Domain d4gqwa_: 4gqw A: [234489]
   automated match to d4gqya_

Details for d4gqwa_

PDB Entry: 4gqw, 2.2 Å

PDB Description: Crystal structure of CBS-pair protein, CBSX1 (loop deletion) from Arabidopsis thaliana

PDB Compounds: (A:) CBS domain-containing protein CBSX1, chloroplastic

SCOPe Domain Sequences for d4gqwa_:

Sequence, based on SEQRES records:

>d4gqwa_ d.37.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvytvgefmtkkedlhvvkptttvdealellvenritgfpvidedwklvglvsdydllal
dsgdstwktfnavqkllsktngklvgdlmtpaplvveektnledaakilletkyrrlpvv
dsdgklvgiitrgnvvraalq

Sequence, based on observed residues (ATOM records):

>d4gqwa_ d.37.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
gvytvgefmtkkedlhvvkptttvdealellvenritgfpvidedwklvglvsdydllal
dtwktfnavqklgklvgdlmtpaplvveektnledaakilletkyrrlpvvdsdgklvgi
itrgnvvraalq

Timeline for d4gqwa_:

• d4gqwa_ is new in SCOPe 2.03-stable
  
• d4gqwa_ appears in SCOPe 2.04
  
• d4gqwa_ appears in the current release, SCOPe 2.08