Lineage for d4gnra_ (4gnr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913572Species Streptococcus pneumoniae [TaxId:637987] [234486] (1 PDB entry)
  8. 2913573Domain d4gnra_: 4gnr A: [234487]
    automated match to d4mlca_
    complexed with cl, ile, mg

Details for d4gnra_

PDB Entry: 4gnr (more details), 1 Å

PDB Description: 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. canada mdr_19a in complex with isoleucine
PDB Compounds: (A:) ABC transporter substrate-binding protein-branched chain amino acid transport

SCOPe Domain Sequences for d4gnra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gnra_ c.93.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 637987]}
ktikigfnfeesgslaaygtaeqkgaqlavdeinaaggidgkqievvdkdnksetaeaas
vttnlvtqskvsavvgpatsgataaavanatkagvplispsatqdgltkgqdylfigtfq
dsfqgkiisnyvseklnakkvvlytdnasdyakgiaksfresykgeivadetfvagdtdf
qaaltkmkgkdfdaivvpgyyneagkivnqargmgidkpivggdgfngeefvqqataeka
sniyfisgfsttvevsakakafldayrakyneepstfaalaydsvhlvanaakgaknsge
ikdnlaktkdfegvtgqtsfdadhntvktaymmtmnngkveaaevvkp

SCOPe Domain Coordinates for d4gnra_:

Click to download the PDB-style file with coordinates for d4gnra_.
(The format of our PDB-style files is described here.)

Timeline for d4gnra_: