Class b: All beta proteins [48724] (180 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.0: automated matches [191402] (1 protein) not a true family |
Protein automated matches [190537] (10 species) not a true protein |
Species Bradyrhizobium japonicum [TaxId:224911] [234468] (3 PDB entries) |
Domain d4ggra_: 4ggr A: [234469] automated match to d4jnja_ |
PDB Entry: 4ggr (more details), 1.9 Å
SCOPe Domain Sequences for d4ggra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ggra_ b.61.1.0 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]} lpapsywknergselliwsansgtiqgtftnhaqgfacqgipypaagsvsptglyfvvtf aqcnsftrwvgtikgsqmptswtlfyvdnkgkpsrlkggdiftrvw
Timeline for d4ggra_: