Lineage for d4ggra_ (4ggr A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2806418Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2806419Protein automated matches [190537] (10 species)
    not a true protein
  7. 2806433Species Bradyrhizobium japonicum [TaxId:224911] [234468] (3 PDB entries)
  8. 2806440Domain d4ggra_: 4ggr A: [234469]
    automated match to d4jnja_

Details for d4ggra_

PDB Entry: 4ggr (more details), 1.9 Å

PDB Description: The structure of apo bradavidin2 (Form A)
PDB Compounds: (A:) Bradavidin 2

SCOPe Domain Sequences for d4ggra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ggra_ b.61.1.0 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
lpapsywknergselliwsansgtiqgtftnhaqgfacqgipypaagsvsptglyfvvtf
aqcnsftrwvgtikgsqmptswtlfyvdnkgkpsrlkggdiftrvw

SCOPe Domain Coordinates for d4ggra_:

Click to download the PDB-style file with coordinates for d4ggra_.
(The format of our PDB-style files is described here.)

Timeline for d4ggra_: