SCOPe 2.06: Domain d4ggnb_: 4ggn B:

Lineage for d4ggnb_ (4ggn B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (30 species)
   not a true protein

7. Species Plasmodium knowlesi [TaxId:5851] [234464] (1 PDB entry)

8. Domain d4ggnb_: 4ggn B: [234465]
   automated match to d1ggwa_

Details for d4ggnb_

PDB Entry: 4ggn, 2.29 Å

PDB Description: malaria invasion machinery protein complex

PDB Compounds: (B:) Myosin A tail domain interacting protein MTIP

SCOPe Domain Sequences for d4ggnb_:

Sequence; same for both SEQRES and ATOM records:

>d4ggnb_ a.39.1.0 (B:) automated matches {Plasmodium knowlesi [TaxId: 5851]}
kdmfntkssngklriedashnarklglapsstdekkirdlygdsltyeqyleyltmcvhd
rdnmeelikmfshfdnnssgfltknqmknilttwgdalteqeandalnafssedrinykl
fcedils

Timeline for d4ggnb_:

• d4ggnb_ first appeared in SCOPe 2.03
  
• d4ggnb_ appears in SCOPe 2.05
  
• d4ggnb_ appears in SCOPe 2.07
  
• d4ggnb_ appears in the current release, SCOPe 2.08