Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily) 12 transmembrane helices in an approximate threefold rotational symmetric arrangement |
Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) |
Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins) the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3 |
Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species) |
Species Thermus thermophilus [TaxId:274] [81437] (29 PDB entries) |
Domain d4g70a_: 4g70 A: [234450] Other proteins in same PDB: d4g70b1, d4g70b2, d4g70c_ automated match to d3qjsa_ complexed with cu, cua, has, hem, olc, per; mutant |
PDB Entry: 4g70 (more details), 2.6 Å
SCOPe Domain Sequences for d4g70a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g70a_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]} srvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqg ltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvfalpllane atvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavv fwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpityfwllpayaiiy tilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavp slmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnas ftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlw flgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiygl fsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvq lfghlnpvpgwrlw
Timeline for d4g70a_: