Lineage for d4g70a_ (4g70 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3026966Fold f.24: Cytochrome c oxidase subunit I-like [81443] (1 superfamily)
    12 transmembrane helices in an approximate threefold rotational symmetric arrangement
  4. 3026967Superfamily f.24.1: Cytochrome c oxidase subunit I-like [81442] (1 family) (S)
  5. 3026968Family f.24.1.1: Cytochrome c oxidase subunit I-like [81441] (5 proteins)
    the largest and best conserved subunit, contains two heme groups, low spin heme a and high spin heme a3
  6. 3026988Protein Bacterial ba3 type cytochrome c oxidase subunit I [81438] (1 species)
  7. 3026989Species Thermus thermophilus [TaxId:274] [81437] (29 PDB entries)
  8. 3027006Domain d4g70a_: 4g70 A: [234450]
    Other proteins in same PDB: d4g70b1, d4g70b2, d4g70c_
    automated match to d3qjsa_
    complexed with cu, cua, has, hem, olc, per; mutant

Details for d4g70a_

PDB Entry: 4g70 (more details), 2.6 Å

PDB Description: Structure of Recombinant Cytochrome ba3 Oxidase mutant V236T from Thermus thermophilus
PDB Compounds: (A:) Cytochrome c oxidase subunit 1

SCOPe Domain Sequences for d4g70a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g70a_ f.24.1.1 (A:) Bacterial ba3 type cytochrome c oxidase subunit I {Thermus thermophilus [TaxId: 274]}
srvyeaypekkatlyflvlgflalivgslfgpfqalnygnvdaypllkrllpfvqsyyqg
ltlhgvlnaivftqlfaqaimvylparelnmrpnmglmwlswwmafiglvvfalpllane
atvlytfypplkghwafylgasvfvlstwvsiyivldlwrrwkaanpgkvtplvtymavv
fwlmwflaslglvleavlfllpwsfglvegvdplvartlfwwtghpityfwllpayaiiy
tilpkqaggklvsdpmarlafllflllstpvgfhhqfadpgidptwkmihsvltlfvavp
slmtaftvaaslefagrlrggrglfgwiralpwdnpafvapvlgllgfipggaggivnas
ftldyvvhntawvpghfhlqvaslvtltamgslywllpnltgkpisdaqrrlglavvwlw
flgmmimavglhwagllnvprrayiaqvpdayphaavpmvfnvlagivllvalllfiygl
fsvllsrerkpelaeaplpfaevisgpedrrlvlamdrigfwfavaailvvlaygptlvq
lfghlnpvpgwrlw

SCOPe Domain Coordinates for d4g70a_:

Click to download the PDB-style file with coordinates for d4g70a_.
(The format of our PDB-style files is described here.)

Timeline for d4g70a_: