Lineage for d4g28b1 (4g28 B:396-487)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252831Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
    oligomeric transmembrane alpha-helical protein
  4. 2252832Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family) (S)
  5. 2252833Family f.15.1.1: Small-conductance potassium channel [81326] (1 protein)
  6. 2252834Protein Small-conductance potassium channel [64528] (1 species)
  7. 2252835Species Norway rat (Rattus norvegicus) [TaxId:10116] [64529] (8 PDB entries)
  8. 2252838Domain d4g28b1: 4g28 B:396-487 [234443]
    Other proteins in same PDB: d4g28b2, d4g28b3, d4g28r_
    automated match to d4j9zb_
    complexed with 0w8, ca, gol, so4

Details for d4g28b1

PDB Entry: 4g28 (more details), 1.63 Å

PDB Description: calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant and ebio-1
PDB Compounds: (B:) Small conductance calcium-activated potassium channel protein 2

SCOPe Domain Sequences for d4g28b1:

Sequence, based on SEQRES records: (download)

>d4g28b1 f.15.1.1 (B:396-487) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rkleltkaekhvhnfmmdtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrk
flqaihqlrsvkmeqrklndqantlvdlaktq

Sequence, based on observed residues (ATOM records): (download)

>d4g28b1 f.15.1.1 (B:396-487) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rkleltkaedtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihql
rsvkmeqrklndqantlvdlaktq

SCOPe Domain Coordinates for d4g28b1:

Click to download the PDB-style file with coordinates for d4g28b1.
(The format of our PDB-style files is described here.)

Timeline for d4g28b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d4g28r_