SCOPe 2.05: Domain d4g27b_: 4g27 B:

Lineage for d4g27b_ (4g27 B:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
   oligomeric transmembrane alpha-helical protein

4. Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family)

5. Family f.15.1.1: Small-conductance potassium channel [81326] (1 protein)

6. Protein Small-conductance potassium channel [64528] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [64529] (8 PDB entries)

8. Domain d4g27b_: 4g27 B: [234442]
   Other proteins in same PDB: d4g27r_
   automated match to d4j9zb_
   complexed with ca, gol, phu, so4

Details for d4g27b_

PDB Entry: 4g27, 1.65 Å

PDB Description: calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant and phenylurea

PDB Compounds: (B:) Small conductance calcium-activated potassium channel protein 2

SCOPe Domain Sequences for d4g27b_:

Sequence, based on SEQRES records:

>d4g27b_ f.15.1.1 (B:) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
grkleltkaekhvhnfmmdtqltkrvknaaanvlretwliykntklvkkidhakvrkhqr
kflqaihqlrsvkmeqrklndqantlvdlaktqle

Sequence, based on observed residues (ATOM records):

>d4g27b_ f.15.1.1 (B:) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
grkleltkaedtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihq
lrsvkmeqrklndqantlvdlaktqle

Timeline for d4g27b_:

• d4g27b_ first appeared in SCOPe 2.03
  
• d4g27b_ appears in SCOPe 2.04
  
• d4g27b_ is called d4g27b1 in SCOPe 2.06
  
• d4g27b_ appears in the current release, SCOPe 2.08, called d4g27b1