SCOPe 2.08: Domain d4g05a_: 4g05 A:

Lineage for d4g05a_ (4g05 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (14 species)
   not a true protein

7. Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries)

8. Domain d4g05a_: 4g05 A: [234441]
   automated match to d4fcna_
   complexed with ca, hem, jz3, so4; mutant

Details for d4g05a_

PDB Entry: 4g05, 2.35 Å

PDB Description: The crystal structures of several mutants of Pleurotus eryngii versatile peroxidase

PDB Compounds: (A:) versatile peroxidase vpl2

SCOPe Domain Sequences for d4g05a_:

Sequence; same for both SEQRES and ATOM records:

>d4g05a_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]}
atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpgpfdsvdsilarmgdagfspvevvwllashsiaaadkvdps
ipgtpfdstpevfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
acewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
sdveqacaatpfpalta

Timeline for d4g05a_:

• d4g05a_ first appeared in SCOPe 2.03
  
• d4g05a_ appears in SCOPe 2.07