Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (71 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [194688] (5 PDB entries) |
Domain d4fzwa_: 4fzw A: [234440] Other proteins in same PDB: d4fzwb2 automated match to d3qxia_ complexed with gol |
PDB Entry: 4fzw (more details), 2.55 Å
SCOPe Domain Sequences for d4fzwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fzwa_ c.14.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} selivsrqqrvllltlnrpaarnalnnallmqlvneleaaatdtsisvcvitgnarffaa gadlnemaekdlaatlndtrpqlwarlqafnkpliaavngyalgagcelallcdvvvage narfglpeitlgimpgaggtqrlirsvgkslaskmvlsgesitaqqaqqaglvsdvfpsd ltleyalqlaskmarhsplalqaakqalrqsqevalqaglaqerqlftllaatedrhegi saflqkrtpdfkgr
Timeline for d4fzwa_:
View in 3D Domains from other chains: (mouse over for more information) d4fzwb1, d4fzwb2, d4fzwc_, d4fzwd_ |