Lineage for d4fzwa_ (4fzw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853677Species Escherichia coli K-12 [TaxId:83333] [194688] (5 PDB entries)
  8. 2853708Domain d4fzwa_: 4fzw A: [234440]
    Other proteins in same PDB: d4fzwb2
    automated match to d3qxia_
    complexed with gol

Details for d4fzwa_

PDB Entry: 4fzw (more details), 2.55 Å

PDB Description: crystal structure of the paaf-paag hydratase-isomerase complex from e.coli
PDB Compounds: (A:) 2,3-dehydroadipyl-CoA hydratase

SCOPe Domain Sequences for d4fzwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fzwa_ c.14.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
selivsrqqrvllltlnrpaarnalnnallmqlvneleaaatdtsisvcvitgnarffaa
gadlnemaekdlaatlndtrpqlwarlqafnkpliaavngyalgagcelallcdvvvage
narfglpeitlgimpgaggtqrlirsvgkslaskmvlsgesitaqqaqqaglvsdvfpsd
ltleyalqlaskmarhsplalqaakqalrqsqevalqaglaqerqlftllaatedrhegi
saflqkrtpdfkgr

SCOPe Domain Coordinates for d4fzwa_:

Click to download the PDB-style file with coordinates for d4fzwa_.
(The format of our PDB-style files is described here.)

Timeline for d4fzwa_: