SCOPe 2.03: Domain d4fzpb_: 4fzp B:

Lineage for d4fzpb_ (4fzp B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.11: AF1782-like [158372] (1 family)
   automatically mapped to Pfam PF04010

5. Family a.8.11.1: AF1782-like [158373] (3 proteins)
   Pfam PF04010; DUF357

6. Protein automated matches [229582] (1 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [229583] (2 PDB entries)

8. Domain d4fzpb_: 4fzp B: [234438]
   automated match to d4fzob_
   complexed with ium

Details for d4fzpb_

PDB Entry: 4fzp, 1.29 Å

PDB Description: Crystal Structure of the uranyl binding protein complexed with uranyl

PDB Compounds: (B:) uranyl binding protein

SCOPe Domain Sequences for d4fzpb_:

Sequence; same for both SEQRES and ATOM records:

>d4fzpb_ a.8.11.1 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
aldcreriekdledlekelmemksiklsddeeavveralnyrddsvyylekgdhitsfgc
ityaegltdslrmlhriieg

Timeline for d4fzpb_:

• d4fzpb_ is new in SCOPe 2.03-stable
  
• d4fzpb_ appears in SCOPe 2.04
  
• d4fzpb_ appears in the current release, SCOPe 2.08, called d4fzpb1