Class b: All beta proteins [48724] (174 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (25 species) not a true protein |
Species Yersinia pseudotuberculosis [TaxId:214092] [234417] (1 PDB entry) |
Domain d4fcea2: 4fce A:252-449 [234418] Other proteins in same PDB: d4fcea1 automated match to d1hv9a1 complexed with edo, gp1, mg |
PDB Entry: 4fce (more details), 1.96 Å
SCOPe Domain Sequences for d4fcea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fcea2 b.81.1.0 (A:252-449) automated matches {Yersinia pseudotuberculosis [TaxId: 214092]} vmlldpsrfdlrgelthgrditidtnviieghvilgdrvrigtgcvlkncvigddseisp ytvledarldanctvgpfarlrpgaelaegahvgnfveikkarlgkgskaghlsylgdae igagvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvangatigagttvtrdv aenelvisrvkqvhiqgw
Timeline for d4fcea2: