SCOPe 2.03: Domain d4fcea2: 4fce A:252-449

Lineage for d4fcea2 (4fce A:252-449)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (25 species)
   not a true protein

7. Species Yersinia pseudotuberculosis [TaxId:214092] [234417] (1 PDB entry)

8. Domain d4fcea2: 4fce A:252-449 [234418]
   Other proteins in same PDB: d4fcea1
   automated match to d1hv9a1
   complexed with edo, gp1, mg

Details for d4fcea2

PDB Entry: 4fce, 1.96 Å

PDB Description: crystal structure of yersinia pestis glmu in complex with alpha-d- glucosamine 1-phosphate (gp1)

PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d4fcea2:

Sequence; same for both SEQRES and ATOM records:

>d4fcea2 b.81.1.0 (A:252-449) automated matches {Yersinia pseudotuberculosis [TaxId: 214092]}
vmlldpsrfdlrgelthgrditidtnviieghvilgdrvrigtgcvlkncvigddseisp
ytvledarldanctvgpfarlrpgaelaegahvgnfveikkarlgkgskaghlsylgdae
igagvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvangatigagttvtrdv
aenelvisrvkqvhiqgw

Timeline for d4fcea2:

• d4fcea2 is new in SCOPe 2.03-stable
  
• d4fcea2 appears in SCOPe 2.04
  
• d4fcea2 appears in the current release, SCOPe 2.08