Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (24 species) |
Species Pig (Sus scrofa) [TaxId:9823] [46507] (3 PDB entries) |
Domain d4f4oh_: 4f4o H: [234410] Other proteins in same PDB: d4f4oa_, d4f4od_, d4f4og_, d4f4oj_ automated match to d1qpwb_ complexed with hem, nag, oxy |
PDB Entry: 4f4o (more details), 2.9 Å
SCOPe Domain Sequences for d4f4oh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f4oh_ a.1.1.2 (H:) Hemoglobin, beta-chain {Pig (Sus scrofa) [TaxId: 9823]} vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh dfnpnvqaafqkvvagvanalahkyh
Timeline for d4f4oh_: