SCOPe 2.03: Domain d4ey2b_: 4ey2 B:

Lineage for d4ey2b_ (4ey2 B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (8 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [189718] (16 PDB entries)

8. Domain d4ey2b_: 4ey2 B: [234408]
   automated match to d3q6xb_
   complexed with 0rm, zn

Details for d4ey2b_

PDB Entry: 4ey2, 1.17 Å

PDB Description: crystal structure of ndm-1 bound to hydrolyzed methicillin

PDB Compounds: (B:) Beta-lactamase NDM-1

SCOPe Domain Sequences for d4ey2b_:

Sequence; same for both SEQRES and ATOM records:

>d4ey2b_ d.157.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv
dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla
pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl
ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl
r

Timeline for d4ey2b_:

• d4ey2b_ is new in SCOPe 2.03-stable
  
• d4ey2b_ appears in SCOPe 2.04
  
• d4ey2b_ appears in the current release, SCOPe 2.08