Lineage for d4emhb_ (4emh B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1312761Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1312762Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1313271Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 1313272Protein automated matches [190914] (7 species)
    not a true protein
  7. 1313313Species Schizosaccharomyces pombe [TaxId:284812] [189773] (4 PDB entries)
  8. 1313315Domain d4emhb_: 4emh B: [234394]
    automated match to d4m78n_

Details for d4emhb_

PDB Entry: 4emh (more details), 2.2 Å

PDB Description: Crystal structure of SpLsm4
PDB Compounds: (B:) Probable U6 snRNA-associated Sm-like protein LSm4

SCOPe Domain Sequences for d4emhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4emhb_ b.38.1.0 (B:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
grpilvelkngetfnghlencdnymnltlrevirtmpdgdkffrlpecyirgnnikylri

SCOPe Domain Coordinates for d4emhb_:

Click to download the PDB-style file with coordinates for d4emhb_.
(The format of our PDB-style files is described here.)

Timeline for d4emhb_: