Lineage for d4egla2 (4egl A:100-184)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195631Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2195632Protein automated matches [190896] (11 species)
    not a true protein
  7. 2195664Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries)
  8. 2195747Domain d4egla2: 4egl A:100-184 [234389]
    automated match to d1fxla2
    complexed with gol, so4

Details for d4egla2

PDB Entry: 4egl (more details), 2.9 Å

PDB Description: Crystal structure of two tandem RNA recognition motifs of Human antigen R
PDB Compounds: (A:) ELAV-like protein 1

SCOPe Domain Sequences for d4egla2:

Sequence, based on SEQRES records: (download)

>d4egla2 d.58.7.0 (A:100-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sevikdanlyisglprtmtqkdvedmfsrfgriinsrvlvdqttglsrgvafirfdkrse
aeeaitsfnghkppgssepitvkfa

Sequence, based on observed residues (ATOM records): (download)

>d4egla2 d.58.7.0 (A:100-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sevikdanlyisglprtmtqkdvedmfsrfgriinsrvlvdqttglsrgvafirfdkrse
aeeaitsfnghkgssepitvkfa

SCOPe Domain Coordinates for d4egla2:

Click to download the PDB-style file with coordinates for d4egla2.
(The format of our PDB-style files is described here.)

Timeline for d4egla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4egla1