SCOPe 2.08: Domain d4ebea2: 4ebe A:300-414

Lineage for d4ebea2 (4ebe A:300-414)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DNA polymerase iota [111015] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111016] (19 PDB entries)
   Uniprot Q9UNA4

8. Domain d4ebea2: 4ebe A:300-414 [234384]
   Other proteins in same PDB: d4ebea1
   automated match to d2dpia1
   protein/DNA complex; complexed with ca, dtp, gol

Details for d4ebea2

PDB Entry: 4ebe, 2.1 Å

PDB Description: conformationally restrained north-methanocarba-2'-deoxyadenosine corrects the error-prone nature of human dna polymerase iota

PDB Compounds: (A:) DNA polymerase iota

SCOPe Domain Sequences for d4ebea2:

Sequence, based on SEQRES records:

>d4ebea2 d.240.1.1 (A:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres
rqcpipshviqklgtgnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

Sequence, based on observed residues (ATOM records):

>d4ebea2 d.240.1.1 (A:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdrkphtvrliirrygresrqcpips
hviqkdvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

Timeline for d4ebea2:

• d4ebea2 first appeared in SCOPe 2.03
  
• d4ebea2 appears in SCOPe 2.07