SCOPe 2.03: Domain d4e8gb2: 4e8g B:127-369

Lineage for d4e8gb2 (4e8g B:127-369)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (45 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:318586] [234379] (1 PDB entry)

8. Domain d4e8gb2: 4e8g B:127-369 [234380]
   Other proteins in same PDB: d4e8ga1, d4e8gb1
   automated match to d4mggf2
   complexed with mg, unl

Details for d4e8gb2

PDB Entry: 4e8g, 2 Å

PDB Description: crystal structure of an enolase (mandelate racemase subgroup) from paracococus denitrificans pd1222 (target nysgrc-012907) with bound mg

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme, N-terminal domain protein

SCOPe Domain Sequences for d4e8gb2:

Sequence; same for both SEQRES and ATOM records:

>d4e8gb2 c.1.11.0 (B:127-369) automated matches {Paracoccus denitrificans [TaxId: 318586]}
vaaervpsyyatgigqpdeiariaaekvaegfprlqikiggrpveidietvrkvwerirg
tgtrlavdgnrslpsrdalrlsrecpeipfvleqpcntleeiaairgrvqhgiyldesge
dlstviraagqglcdgfgmkltrigglqqmaafrdicearalphscddawggdiiaaact
higatvqprlnegvwvaqpyiaqpydeengiriagghidlpkgpglgitpdeslfgppva
sfs

Timeline for d4e8gb2:

• d4e8gb2 is new in SCOPe 2.03-stable
  
• d4e8gb2 appears in SCOPe 2.04
  
• d4e8gb2 appears in the current release, SCOPe 2.08