SCOPe 2.04: Domain d4egla1: 4egl A:18-99

Lineage for d4egla1 (4egl A:18-99)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (59 PDB entries)

8. Domain d4egla1: 4egl A:18-99 [234378]
   automated match to d1fxla1
   complexed with gol, so4

Details for d4egla1

PDB Entry: 4egl, 2.9 Å

PDB Description: Crystal structure of two tandem RNA recognition motifs of Human antigen R

PDB Compounds: (A:) ELAV-like protein 1

SCOPe Domain Sequences for d4egla1:

Sequence; same for both SEQRES and ATOM records:

>d4egla1 d.58.7.0 (A:18-99) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaera
intlnglrlqsktikvsyarps

Timeline for d4egla1:

• d4egla1 first appeared in SCOPe 2.03
  
• d4egla1 appears in SCOPe 2.05
  
• d4egla1 appears in the current release, SCOPe 2.08