Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188315] (18 PDB entries) |
Domain d4egla1: 4egl A:18-99 [234378] automated match to d1fxla1 complexed with gol, so4 |
PDB Entry: 4egl (more details), 2.9 Å
SCOPe Domain Sequences for d4egla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4egla1 d.58.7.0 (A:18-99) automated matches {Human (Homo sapiens) [TaxId: 9606]} grtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaera intlnglrlqsktikvsyarps
Timeline for d4egla1: