Lineage for d4egla1 (4egl A:18-99)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952511Species Human (Homo sapiens) [TaxId:9606] [188315] (106 PDB entries)
  8. 2952599Domain d4egla1: 4egl A:18-99 [234378]
    automated match to d1fxla1
    complexed with gol, so4

Details for d4egla1

PDB Entry: 4egl (more details), 2.9 Å

PDB Description: Crystal structure of two tandem RNA recognition motifs of Human antigen R
PDB Compounds: (A:) ELAV-like protein 1

SCOPe Domain Sequences for d4egla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4egla1 d.58.7.0 (A:18-99) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grtnlivnylpqnmtqdelrslfssigevesaklirdkvaghslgygfvnyvtakdaera
intlnglrlqsktikvsyarps

SCOPe Domain Coordinates for d4egla1:

Click to download the PDB-style file with coordinates for d4egla1.
(The format of our PDB-style files is described here.)

Timeline for d4egla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4egla2