SCOPe 2.08: Domain d4ebea1: 4ebe A:26-299

Lineage for d4ebea1 (4ebe A:26-299)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
   contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein DNA polymerase iota [111295] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111296] (19 PDB entries)
   Uniprot Q9UNA4

8. Domain d4ebea1: 4ebe A:26-299 [234370]
   Other proteins in same PDB: d4ebea2
   automated match to d2dpia2
   protein/DNA complex; complexed with ca, dtp, gol

Details for d4ebea1

PDB Entry: 4ebe, 2.1 Å

PDB Description: conformationally restrained north-methanocarba-2'-deoxyadenosine corrects the error-prone nature of human dna polymerase iota

PDB Compounds: (A:) DNA polymerase iota

SCOPe Domain Sequences for d4ebea1:

Sequence; same for both SEQRES and ATOM records:

>d4ebea1 e.8.1.7 (A:26-299) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
ssrvivhvdldcfyaqvemisnpelkdkplgvqqkylvvtcnyearklgvkklmnvrdak
ekcpqlvlvngedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlqs
delsavtvsghvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnkll
aklvsgvfkpnqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtfs
pkilekelgisvaqriqklsfgednspvilsgpp

Timeline for d4ebea1:

• d4ebea1 first appeared in SCOPe 2.03
  
• d4ebea1 appears in SCOPe 2.07