Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (121 species) not a true protein |
Species Vibrio fluvialis [TaxId:676] [233050] (3 PDB entries) |
Domain d4e3qb_: 4e3q B: [234358] automated match to d4grxa_ complexed with ben, na, pmp, so4 |
PDB Entry: 4e3q (more details), 1.9 Å
SCOPe Domain Sequences for d4e3qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e3qb_ c.67.1.0 (B:) automated matches {Vibrio fluvialis [TaxId: 676]} pqswearaetyslygftdmpslhqrgtvvvthgegpyivdvngrryldansglwnmvagf dhkglidaakaqyerfpgyhaffgrmsdqtvmlseklvevspfdsgrvfytnsgseandt mvkmlwflhaaegkpqkrkiltrwnayhgvtavsasmtgkpynsvfglplpgfvhltcph ywrygeegeteeqfvarlareleetiqregadtiagffaepvmgaggvippakgyfqail pilrkydipvisdevicgfgrtgntwgcvtydftpdaiissknltagffpmgavilgpel skrletaieaieefphgftasghpvgcaialkaidvvmneglaenvrrlaprfeerlkhi aerpnigeyrgigfmwaleavkdkasktpfdgnlsvseriantctdlglicrplgqsvvl cppfilteaqmdemfdklekaldkvfaeva
Timeline for d4e3qb_: