SCOPe 2.03: Domain d4dk4a_: 4dk4 A:

Lineage for d4dk4a_ (4dk4 A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.0: automated matches [191410] (1 protein)
   not a true family

6. Protein automated matches [190562] (4 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:5691] [234324] (1 PDB entry)

8. Domain d4dk4a_: 4dk4 A: [234325]
   automated match to d1ogla_
   complexed with ca, dun, na

Details for d4dk4a_

PDB Entry: 4dk4, 1.9 Å

PDB Description: Crystal Structure of Trypanosoma brucei dUTPase with dUpNp, Ca2+ and Na+

PDB Compounds: (A:) deoxyuridine triphosphatase

SCOPe Domain Sequences for d4dk4a_:

Sequence, based on SEQRES records:

>d4dk4a_ a.204.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 5691]}
slsplilrslaelqdglntvvdknwrqlrrpgdwslaitmeaaelldsypwkwwknvkaq
pdlqnvkieltdilhfslsgamqvsdensgavhkaeagsngesgkhwcyfdqpralpaag
gaeyvacvetpgsslsapvsadecdladfmffplsdtnnalasfqniirlaslqrfqlvt
saviaaaddigfnlvayyvakhtlngirqmkgykdgtyvkvqkgvednellhgcispfsl
ddvtnegnyktkwddimhrvydafgtpkeerlnighwlk

Sequence, based on observed residues (ATOM records):

>d4dk4a_ a.204.1.0 (A:) automated matches {Trypanosoma brucei [TaxId: 5691]}
slsplilrslaelqdglntvvdknwrqlrrpgdwslaitmeaaelldsypwkwwknvkaq
pdlqnvkieltdilhfslsgamqvsadfmffplsdtnnalasfqniirlaslqrfqlvts
aviaaaddigfnlvayyvakhtlngirqmkgykdgtyvkvqkgvednellhgcispfsld
dvtnegnyktkwddimhrvydafgtpkeerlnighwlk

Timeline for d4dk4a_:

• d4dk4a_ is new in SCOPe 2.03-stable
  
• d4dk4a_ appears in SCOPe 2.04
  
• d4dk4a_ appears in the current release, SCOPe 2.08