SCOPe 2.03: Domain d4dbeb_: 4dbe B:

Lineage for d4dbeb_ (4dbe B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (20 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:555311] [234306] (2 PDB entries)

8. Domain d4dbeb_: 4dbe B: [234309]
   automated match to d3ve7b_
   complexed with bmp, gol, so4

Details for d4dbeb_

PDB Entry: 4dbe, 1.79 Å

PDB Description: Crystal structure of orotidine 5'-monophosphate decarboxylase from Sulfolobus solfataricus complexed with inhibitor BMP

PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d4dbeb_:

Sequence; same for both SEQRES and ATOM records:

>d4dbeb_ c.1.2.0 (B:) automated matches {Sulfolobus solfataricus [TaxId: 555311]}
ksrvilamdkplsyqvlkemenelygikvglplvldlgvdktrelligldveeiivdfkl
adigyimksiverlsfansfiahsfigvkgsldelkryldansknlylvavmshegwstl
fadyiknvireispkgivvggtkldhitqyrrdfekmtivspgmgsqggsygdavcagad
yeiigrsiynagnpltalrtinkiiedkvmkck

Timeline for d4dbeb_:

• d4dbeb_ is new in SCOPe 2.03-stable
  
• d4dbeb_ appears in SCOPe 2.04
  
• d4dbeb_ appears in the current release, SCOPe 2.08