Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
Protein automated matches [190457] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187598] (23 PDB entries) |
Domain d4cc4b_: 4cc4 B: [234303] Other proteins in same PDB: d4cc4a1, d4cc4a2, d4cc4c1, d4cc4c2, d4cc4e1, d4cc4e2 automated match to d4cc4f_ complexed with cl, gol, pe4, po4, so4 |
PDB Entry: 4cc4 (more details), 2.6 Å
SCOPe Domain Sequences for d4cc4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cc4b_ b.34.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gpegnqvyfavytfkarnpnelsvsanqklkilefkdvtgntewwlaevngkkgyvpsny irkteyta
Timeline for d4cc4b_: