Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (43 species) not a true protein |
Species Listeria monocytogenes [TaxId:169963] [225327] (7 PDB entries) |
Domain d4cc4a2: 4cc4 A:220-297 [234302] Other proteins in same PDB: d4cc4a1, d4cc4b_, d4cc4c1, d4cc4d_, d4cc4e1, d4cc4f_ automated match to d4cc4e2 complexed with cl, gol, pe4, po4, so4 |
PDB Entry: 4cc4 (more details), 2.6 Å
SCOPe Domain Sequences for d4cc4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cc4a2 b.1.18.0 (A:220-297) automated matches {Listeria monocytogenes [TaxId: 169963]} nepvkyqpelyitntvkdpdgrwispaaisnggsyvdgcvlwelpvytdevsykfseyin vgeteaifdgtvtqpikn
Timeline for d4cc4a2: