Lineage for d4cc4a2 (4cc4 A:220-297)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771214Species Listeria monocytogenes [TaxId:169963] [225327] (7 PDB entries)
  8. 1771229Domain d4cc4a2: 4cc4 A:220-297 [234302]
    Other proteins in same PDB: d4cc4a1, d4cc4b_, d4cc4c1, d4cc4d_, d4cc4e1, d4cc4f_
    automated match to d4cc4e2
    complexed with cl, gol, pe4, po4, so4

Details for d4cc4a2

PDB Entry: 4cc4 (more details), 2.6 Å

PDB Description: complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain
PDB Compounds: (A:) inlc protein

SCOPe Domain Sequences for d4cc4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cc4a2 b.1.18.0 (A:220-297) automated matches {Listeria monocytogenes [TaxId: 169963]}
nepvkyqpelyitntvkdpdgrwispaaisnggsyvdgcvlwelpvytdevsykfseyin
vgeteaifdgtvtqpikn

SCOPe Domain Coordinates for d4cc4a2:

Click to download the PDB-style file with coordinates for d4cc4a2.
(The format of our PDB-style files is described here.)

Timeline for d4cc4a2: