Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins) automatically mapped to Pfam PF00850 |
Protein automated matches [190786] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188039] (41 PDB entries) |
Domain d4cbyc_: 4cby C: [234299] Other proteins in same PDB: d4cbyd2 automated match to d4cbya_ complexed with kee, na, zn |
PDB Entry: 4cby (more details), 2.72 Å
SCOPe Domain Sequences for d4cbyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cbyc_ c.42.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ttglvydtlmlkhqctcgsssshpehagriqsiwsrlqetglrgkcecirgrkatleelq tvhseahtllygtnpanrqkldskkllgslasvfvrlpcggvgvdsdtiwnevhsagaar lavgcvvelvfkvatgelkngfavvrppghhaeestpmgfcyfnsvavaakllqqrlsvs kilivdwdvhhgngtqqafysdpsvlymslhryddgnffpgsgapdevgtgpgvgfnvnm aftggldppmgdaeylaafrtvvmpiasefapdvvlvssgfdaveghptplggynlsarc fgyltkqlmglaggrivlalegghdltaicdaseacvsallgneldplpekvlqqrpnan avrsmekvmeihskywrclq
Timeline for d4cbyc_:
View in 3D Domains from other chains: (mouse over for more information) d4cbya_, d4cbyb_, d4cbyd1, d4cbyd2 |