SCOPe 2.06: Domain d4c92d_: 4c92 D:

Lineage for d4c92d_ (4c92 D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.0: automated matches [191538] (1 protein)
   not a true family

6. Protein automated matches [190914] (13 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188389] (6 PDB entries)

8. Domain d4c92d_: 4c92 D: [234294]
   Other proteins in same PDB: d4c92b2
   automated match to d4m78n_
   protein/RNA complex

Details for d4c92d_

PDB Entry: 4c92, 2.3 Å

PDB Description: Crystal structure of the yeast Lsm1-7 complex

PDB Compounds: (D:) u6 snrna-associated sm-like protein lsm4

SCOPe Domain Sequences for d4c92d_:

Sequence; same for both SEQRES and ATOM records:

>d4c92d_ b.38.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mlplylltnakgqqmqielkngeiiqgiltnvdnwmnltlsnvteyseesainsednaes
skavklneiyirgtfikfiklqdn

Timeline for d4c92d_:

• d4c92d_ first appeared in SCOPe 2.03
  
• d4c92d_ appears in SCOPe 2.05
  
• d4c92d_ appears in SCOPe 2.07
  
• d4c92d_ appears in the current release, SCOPe 2.08