SCOPe 2.03: Domain d4c4na_: 4c4n A:

Lineage for d4c4na_ (4c4n A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families)
   zinc-binding motif

5. Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
   automatically mapped to Pfam PF01085

6. Protein automated matches [190324] (2 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [228020] (2 PDB entries)

8. Domain d4c4na_: 4c4n A: [234289]
   automated match to d4c4ma_
   complexed with ca, cl, zn

Details for d4c4na_

PDB Entry: 4c4n, 2.36 Å

PDB Description: crystal structure of the sonic hedgehog-heparin complex

PDB Compounds: (A:) Sonic hedgehog protein

SCOPe Domain Sequences for d4c4na_:

Sequence; same for both SEQRES and ATOM records:

>d4c4na_ d.65.1.2 (A:) automated matches {Mus musculus [TaxId: 10090]}
ltplaykqfipnvaektlgasgryegkitrnserfkeltpnynpdiifkdeentgadrlm
tqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhyegravdittsdrdrsky
gmlarlaveagfdwvyyeskahihcsvkaen

Timeline for d4c4na_:

• d4c4na_ is new in SCOPe 2.03-stable
  
• d4c4na_ appears in SCOPe 2.04
  
• d4c4na_ appears in the current release, SCOPe 2.08