Lineage for d4bx3a_ (4bx3 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1393810Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1393811Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1394417Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1394418Protein automated matches [190447] (43 species)
    not a true protein
  7. 1394641Species Mouse (Mus musculus) [TaxId:10090] [193863] (5 PDB entries)
  8. 1394647Domain d4bx3a_: 4bx3 A: [234281]
    automated match to d4bx3b_
    complexed with gol, mg

Details for d4bx3a_

PDB Entry: 4bx3 (more details), 2.19 Å

PDB Description: Crystal Structure of murine Chronophin (Pyridoxal Phosphate Phosphatase)
PDB Compounds: (A:) pyridoxal phosphate phosphatase

SCOPe Domain Sequences for d4bx3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bx3a_ c.108.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsn
nsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlpgppdasgavfvlggeglr
aelraaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhp
lsdgsrtpgtgslaaavetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletd
ilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegl

SCOPe Domain Coordinates for d4bx3a_:

Click to download the PDB-style file with coordinates for d4bx3a_.
(The format of our PDB-style files is described here.)

Timeline for d4bx3a_: