SCOPe 2.03: Domain d4bsqa_: 4bsq A:

Lineage for d4bsqa_ (4bsq A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein automated matches [190264] (9 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [229208] (2 PDB entries)

8. Domain d4bsqa_: 4bsq A: [234279]
   automated match to d4bs5a_
   complexed with qqv, so4

Details for d4bsqa_

PDB Entry: 4bsq, 1.96 Å

PDB Description: mouse cathepsin s with covalent ligand

PDB Compounds: (A:) cathepsin S

SCOPe Domain Sequences for d4bsqa_:

Sequence; same for both SEQRES and ATOM records:

>d4bsqa_ d.3.1.1 (A:) automated matches {Mus musculus [TaxId: 10090]}
tlpdtvdwrekgcvtevkyqgscgacwafsavgalegqlklktgklislsaqnlvdcsne
ekygnkgcgggymteafqyiidnggieadasypykamdekchynsknraatcsryiqlpf
gdedalkeavatkgpvsvgidashssfffyksgvyddpsctgnvnhgvlvvgygtldgkd
ywlvknswglnfgdqgyirmarnnknhcgiasycsypei

Timeline for d4bsqa_:

• d4bsqa_ is new in SCOPe 2.03-stable
  
• d4bsqa_ appears in SCOPe 2.04
  
• d4bsqa_ appears in the current release, SCOPe 2.08