SCOPe 2.08: Domain d4bpca1: 4bpc A:1368-1688

Lineage for d4bpca1 (4bpc A:1368-1688)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein automated matches [190252] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187034] (47 PDB entries)

8. Domain d4bpca1: 4bpc A:1368-1688 [234274]
   automated match to d1lara1

Details for d4bpca1

PDB Entry: 4bpc, 2.1 Å

PDB Description: structure of the catalytic domain of protein tyrosine phosphatase sigma in the sulfenic acid form

PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase S

SCOPe Domain Sequences for d4bpca1:

Sequence; same for both SEQRES and ATOM records:

>d4bpca1 c.45.1.2 (A:1368-1688) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lshppipiadmaehterlkandslklsqeyesidpgqqftwehsnlevnkpknryanvia
ydhsrvilqpiegimgsdyinanyvdgyrrqnayiatqgplpetfgdfwrmvweqrsati
vmmtrleeksrikcdqywpnrgtetygfiqvtlldtielatfavrtfslhkngssekrev
rqfqftawpdhgvpeyptpflaflrrvktanppdagpivvhcsagvgrtgafividamle
rikpektvdvyghvtlmrsqrnymvqtedqysfihealleavgagntevparslyayiqk
laqvepgehvtgmelefkrla

Timeline for d4bpca1:

• d4bpca1 first appeared in SCOPe 2.03
  
• d4bpca1 appears in SCOPe 2.07