SCOPe 2.05: Domain d4bn0c_: 4bn0 C:

Lineage for d4bn0c_ (4bn0 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (36 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [227827] (5 PDB entries)

8. Domain d4bn0c_: 4bn0 C: [234204]
   automated match to d4bn0a_
   mutant

Details for d4bn0c_

PDB Entry: 4bn0, 2.11 Å

PDB Description: Structure of futalosine hydrolase mutant of Helicobacter pylori strain 26695

PDB Compounds: (C:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d4bn0c_:

Sequence, based on SEQRES records:

>d4bn0c_ c.56.2.0 (C:) automated matches {Helicobacter pylori [TaxId: 85962]}
shmvqkigilgamreqitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhs
tltttsmilafgvqkvlfsgvagslvkdlkindllvaiqlvqhdvdlsafdhplgfipes
aifietseslnalakevaneqhivlkegviasgdqfvhskerkeflvsefkasavemega
svafvcqkfgvpccvlrsisdnadeeanmsfdafleksaqtsakflksmvdel

Sequence, based on observed residues (ATOM records):

>d4bn0c_ c.56.2.0 (C:) automated matches {Helicobacter pylori [TaxId: 85962]}
shmvqkigilgamreqitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhs
tltttsmilafgvqkvlfsgvagslvkdlkindllvaiqlvqhdvdlsafdhplgfipes
aifietseslnalakevaneqhivlkegviasgdqfvhskerkeflvsefkasavemega
svafvcqkfgvpccvlrsiseksaqtsakflksmvdel

Timeline for d4bn0c_:

• d4bn0c_ first appeared in SCOPe 2.03
  
• d4bn0c_ appears in SCOPe 2.04
  
• d4bn0c_ is called d4bn0c1 in SCOPe 2.06
  
• d4bn0c_ appears in the current release, SCOPe 2.08, called d4bn0c1