SCOPe 2.03: Domain d4bmxb_: 4bmx B:

Lineage for d4bmxb_ (4bmx B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (23 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [227827] (5 PDB entries)

8. Domain d4bmxb_: 4bmx B: [234201]
   automated match to d4bmxa_
   complexed with ade, trs

Details for d4bmxb_

PDB Entry: 4bmx, 1.76 Å

PDB Description: Native structure of futalosine hydrolase of Helicobacter pylori strain 26695

PDB Compounds: (B:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d4bmxb_:

Sequence; same for both SEQRES and ATOM records:

>d4bmxb_ c.56.2.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]}
shmvqkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhs
tltttsmilafgvqkvlfsgvagslvkdlkindllvaiqlvqhdvdlsafdhplgfipes
aifietseslnalakevaneqhivlkegviasgdqfvhskerkeflvsefkasavemega
svafvcqkfgvpccvlrsisdnadeeanmsfdafleksaqtsakflksmvdel

Timeline for d4bmxb_:

• d4bmxb_ is new in SCOPe 2.03-stable
  
• d4bmxb_ appears in SCOPe 2.04
  
• d4bmxb_ appears in the current release, SCOPe 2.08, called d4bmxb1