Lineage for d4bm7b1 (4bm7 B:238-341)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765361Domain d4bm7b1: 4bm7 B:238-341 [234199]
    automated match to d1igtb3
    complexed with cl; mutant

Details for d4bm7b1

PDB Entry: 4bm7 (more details), 1.95 Å

PDB Description: crystal structure of igg fc f241a mutant with native glycosylation
PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4bm7b1:

Sequence, based on SEQRES records: (download)

>d4bm7b1 b.1.1.0 (B:238-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psvalfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

Sequence, based on observed residues (ATOM records): (download)

>d4bm7b1 b.1.1.0 (B:238-341) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psvalfppkpkdtlmisrtpevtcvvfnwyvdgvevhnaktkpreeqrvvsvltvlhqdw
lngkeykckvektiskakg

SCOPe Domain Coordinates for d4bm7b1:

Click to download the PDB-style file with coordinates for d4bm7b1.
(The format of our PDB-style files is described here.)

Timeline for d4bm7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bm7b2