Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Escherichia coli [TaxId:562] [187725] (4 PDB entries) |
Domain d4bhtf2: 4bht F:197-447 [234172] Other proteins in same PDB: d4bhta1, d4bhtb1, d4bhtc1, d4bhtd1, d4bhte1, d4bhtf1 automated match to d4fcca2 complexed with epe, gol, pg4 |
PDB Entry: 4bht (more details), 2.5 Å
SCOPe Domain Sequences for d4bhtf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bhtf2 c.2.1.0 (F:197-447) automated matches {Escherichia coli [TaxId: 562]} kglsfggslirpeatgyglvyfteamlkrhgmgfegmrvsvsgsgnvaqyaiekamefga rvitasdssgtvvdesgftkeklarlieikasrdgrvadyakefglvylegqqpwslpvd ialpcatqneldvdaahqliangvkavaeganmpttieatelfqqagvlfapgkaanagg vatsglemaqnaarlgwkaekvdarlhhimldihhacvehggegeqtnyvqganiagfvk vadamlaqgvi
Timeline for d4bhtf2: