Lineage for d4bboa_ (4bbo A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2806418Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2806419Protein automated matches [190537] (10 species)
    not a true protein
  7. 2806441Species Bradyrhizobium japonicum [TaxId:375] [228284] (2 PDB entries)
  8. 2806442Domain d4bboa_: 4bbo A: [234145]
    automated match to d4bbod_
    complexed with act, btn, gol

Details for d4bboa_

PDB Entry: 4bbo (more details), 1.6 Å

PDB Description: crystal structure of core-bradavidin
PDB Compounds: (A:) blr5658 protein

SCOPe Domain Sequences for d4bboa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bboa_ b.61.1.0 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 375]}
qsvnwtwtnqygstlaitsfnsntgaitgtytnnaanscdegkpqgvtgwlaygntgtai
sfsvnflgcgsttvwtgqlnnatgfqglwylslaeavawngisagadtftfss

SCOPe Domain Coordinates for d4bboa_:

Click to download the PDB-style file with coordinates for d4bboa_.
(The format of our PDB-style files is described here.)

Timeline for d4bboa_: