Lineage for d4baeb_ (4bae B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1429695Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1429696Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1430131Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1430132Protein automated matches [226867] (10 species)
    not a true protein
  7. 1430176Species Mycobacterium smegmatis [TaxId:1772] [228578] (1 PDB entry)
  8. 1430178Domain d4baeb_: 4bae B: [234132]
    automated match to d4baed_
    complexed with ca, rwx, so4

Details for d4baeb_

PDB Entry: 4bae (more details), 2.35 Å

PDB Description: optimisation of pyrroleamides as mycobacterial gyrb atpase inhibitors: structure activity relationship and in vivo efficacy in the mouse model of tuberculosis
PDB Compounds: (B:) DNA gyrase subunit b

SCOPe Domain Sequences for d4baeb_:

Sequence, based on SEQRES records: (download)

>d4baeb_ d.122.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
gleavrkrpgmyigstgerglhhliwevvdnavdeamagfatrvdvkihadgsvevrddg
rgipvemhatgmptidvvmtqlhaggkfdgetyavsgglhgvgvsvvnalstrleatvlr
dgyewfqyydrsvpgklkqggetketgttirfwadpeifettdynfetvarrlqemafln
kgltieltderdgkhrvfhyp

Sequence, based on observed residues (ATOM records): (download)

>d4baeb_ d.122.1.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
gleavrkrpgmyigstgerglhhliwevvdnavdeamagfatrvdvkihadgsvevrddg
rgipvemhatgmptidvvmtqlgvgvsvvnalstrleatvlrdgyewfqyydrsvpgklk
qggetketgttirfwadpeifettdynfetvarrlqemaflnkgltieltderdgkhrvf
hyp

SCOPe Domain Coordinates for d4baeb_:

Click to download the PDB-style file with coordinates for d4baeb_.
(The format of our PDB-style files is described here.)

Timeline for d4baeb_: