SCOPe 2.06: Domain d4aw4b2: 4aw4 B:263-342

Lineage for d4aw4b2 (4aw4 B:263-342)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (55 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [225327] (7 PDB entries)

8. Domain d4aw4b2: 4aw4 B:263-342 [234104]
   Other proteins in same PDB: d4aw4a1, d4aw4b1, d4aw4c1
   automated match to d1h6ua1
   complexed with gol, so4

Details for d4aw4b2

PDB Entry: 4aw4, 1.93 Å

PDB Description: engineered variant of listeria monocytogenes inlb internalin domain with an additional leucine rich repeat inserted

PDB Compounds: (B:) internalin b

SCOPe Domain Sequences for d4aw4b2:

Sequence; same for both SEQRES and ATOM records:

>d4aw4b2 b.1.18.0 (B:263-342) automated matches {Listeria monocytogenes [TaxId: 169963]}
eclnkpinhqsnlvvpntvkntdgslvtpeiisddgdyekpnvkwhlpeftnevsfifyq
pvtigkakarfhgrvtqplk

Timeline for d4aw4b2:

• d4aw4b2 first appeared in SCOPe 2.03
  
• d4aw4b2 appears in SCOPe 2.05
  
• d4aw4b2 appears in SCOPe 2.07
  
• d4aw4b2 appears in the current release, SCOPe 2.08