Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (11 proteins) |
Protein automated matches [190569] (9 species) not a true protein |
Species Escherichia coli [TaxId:364106] [234099] (1 PDB entry) |
Domain d4av4a_: 4av4 A: [234100] automated match to d4av5a_ complexed with fvq |
PDB Entry: 4av4 (more details), 1.9 Å
SCOPe Domain Sequences for d4av4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4av4a_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 364106]} facktangtaipigggsanvyvnlapvvnvgqnlvvnlstqifchndypetitdyvtlqr gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai kagsliavlilrqtnnynsddfqfvwniyanndvvvpt
Timeline for d4av4a_: