SCOPe 2.04: Domain d4am1a1: 4am1 A:1-95

Lineage for d4am1a1 (4am1 A:1-95)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.0: automated matches [227170] (1 protein)
   not a true family

6. Protein automated matches [226884] (6 species)
   not a true protein

7. Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [227655] (3 PDB entries)

8. Domain d4am1a1: 4am1 A:1-95 [234072]
   Other proteins in same PDB: d4am1a2
   automated match to d1m15a1

Details for d4am1a1

PDB Entry: 4am1, 1.25 Å

PDB Description: Crystal structure of the marine crustacean decapod shrimp (Litopenaeus vannamei) arginine kinase in the absence of substrate or ligands.

PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d4am1a1:

Sequence; same for both SEQRES and ATOM records:

>d4am1a1 a.83.1.0 (A:1-95) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
gadaaviekleagfkkleaatdcksllkkyltkevfdklkdkktslgatlldviqsgven
ldsgvgiyapdaeaytlfaplfdpiiedyhvgfkq

Timeline for d4am1a1:

• d4am1a1 first appeared in SCOPe 2.03
  
• d4am1a1 appears in SCOPe 2.05
  
• d4am1a1 appears in the current release, SCOPe 2.08