SCOPe 2.03: Domain d4aa7b1: 4aa7 B:252-453

Lineage for d4aa7b1 (4aa7 B:252-453)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
   this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain

6. Protein automated matches [227078] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [234048] (1 PDB entry)

8. Domain d4aa7b1: 4aa7 B:252-453 [234050]
   Other proteins in same PDB: d4aa7a1
   automated match to d1hv9a1
   complexed with r82, so4

Details for d4aa7b1

PDB Entry: 4aa7, 2 Å

PDB Description: e.coli glmu in complex with an antibacterial inhibitor

PDB Compounds: (B:) Bifunctional protein glmU

SCOPe Domain Sequences for d4aa7b1:

Sequence; same for both SEQRES and ATOM records:

>d4aa7b1 b.81.1.4 (B:252-453) automated matches {Escherichia coli [TaxId: 83333]}
vmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsvigddceisp
ytvvedanlaaactigpfarlrpgaellegahvgnfvemkkarlgkgskaghltylgdae
igdnvnigagtitcnydgankfktiigddvfvgsdtqlvapvtvgkgatiaagttvtrnv
genalaisrvpqtqkegwrrpv

Timeline for d4aa7b1:

• d4aa7b1 is new in SCOPe 2.03-stable
  
• d4aa7b1 appears in SCOPe 2.04
  
• d4aa7b1 appears in the current release, SCOPe 2.08